ELISA Recombinant Yarrowia lipolytica Cytochrome c oxidase subunit 3(COX3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q9B6D8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLTLKKFQVHPFHLVAPSPWPILVSFSVMSImLTLVFNMHGFMHNNYWVVFSAIVAIMT MALWFRDIISEATYLGDHTLAVRKGLNIGFILFVVSELFFFIAIFWAFFHSAMAPTIELG GVWPPVGIEAIGPSELPLLNTILLLCSGATLTWSHHALLGGNRFNTLLGLILTIALAVTF MICQYMEYSNAPFTISDGIFGSVFYFGTGFHGLHIIIGIImLGVSLWRIYTYQLTNNHHV GYETSILYYHFVDVVWLFLYIVFYWWGT Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III Gene Names:Name:COX3 Expression Region:1-268 Sequence Info:fµLl length protein