ELISA Recombinant Schistosoma haematobium Tetraspanning orphan receptor(TOR)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schistosoma haematobium (Blood fluke) Uniprot NO.:Q9BLM6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:PQCESETNFHYDIPPGYKDDVLVDVNNMSPSLVSDTQKHERGSHEVKIKHFSPYIAVCVT TFSLAFCCFMVHAAITRQPTHLLPFFFIQVFDLIICLIHILGFMSSTSDIRLVIHTKTGP IYIKSTGLTFIILSISCMmLAFKAYCLGMVWDCYKYLmLNRRGNLLDDWYSDQWGHLSTF WSLLRTGRNRGNNSIGNSGSPNEPNTRPRPDTITYDPANDLPKYEDILKIRNAYAPPPYY CSNTNGNVNTTTTDAVTTNTTITSATTANATTTITTNANTNTSTTTSVISPLTTTNKDDT QINNASSNAHSSC Protein Names:Recommended name: Tetraspanning orphan receptor Alternative name(s): Complement C2 receptor inhibitor tetraspanning Complement C2 receptor inhibitor trispanning Trispanning orphan receptor Short name= Sh-TOR Gene Names:Name:TOR Synonyms:TM3 Expression Region:1-313 Sequence Info:fµLl length protein