Skip to Content

ELISA Recombinant Trypanosoma brucei brucei GPI mannosyltransferase 1(M)

https://www.anagnostics.com/web/image/product.template/160278/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trypanosoma brucei brucei (strain 927/4 GUTat10.1) Uniprot NO.:Q9BPQ5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELQSLIDTVSLQKLLLLGALLRLILIAYAFFHDQWFRVKYTDIDYMIVVDGARHMWNGG SPFDRTTFRYTPLLAALVMPSIWIANPMGKLIFASSDLGAAWYCYGVLKSFAKERSAKWM VSLFILFNPIVLSVSTRGNSDmLVTFMSLMVLSKFARRKCYQAAAVLGFAVHFKIYPIIY ALPLTLGVWEQSVAASTNTWRRVVKTAVVVSICALMAAISFAVPTVLCYMKYGQQYLNEA FIYHVYREDHRHNFSPYWLLMYLNMARRHLGQGVDFSPRLVAFAPQAVVLSFVSYKLRRN TAHACCVQTVLFVAFNKVCTVQYFVWFIPFLAFLFCEPKEVEDDESGGSGAFKFFSWVKA LGVVLMWAATIPLWVTTAVPLEFHGYSDFAQLWIVSCLFFLAMVVLASmLARIAYRVQCT KCSAKSIKVA Protein Names:Recommended name: GPI mannosyltransferase 1 EC= 2.4.1.- Alternative name(s): GPI mannosyltransferase I Short name= GPI-MT-I Phosphatidylinositol-glycan biosynthesis class M protein Short name= PIG-M TbPIG-M Gene Names:Name:PIGM ORF Names:Tb927.6.3300 Expression Region:1-430 Sequence Info:fµLl length protein

1,789.00 € 1789.0 EUR 1,789.00 €

1,789.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.