ELISA Recombinant Rhopalosiphum padi ATP synthase subunit a(MT-ATP6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhopalosiphum padi (Bird cherry-oat aphid) (Aphis padi) Uniprot NO.:Q9B6H6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTNLFNIFDPSTTIFNLEMNWISTLLIILFMPNFLWILPNRMNWLLFKMFNmLNNEmLM LYKMKKTKSPAFLFISLFMFILLNNFFSLFPYIFSSSSHMVFSVTLAIPFWMFFIILSTC KNTKNMIAHLIPLNTPIYLAPLMTIIETMSIIIRPMSLSIRLTANLIAGHLLMTLLNFNS LMIIIIFIQMFMMIFELCVALIQSYVFSILSSLYSSE Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6 Gene Names:Name:MT-ATP6 Synonyms:ATP6, ATPASE6, MTATP6 Expression Region:1-217 Sequence Info:fµLl length protein