ELISA Recombinant Zea mays Aquaporin TIP4-2(TIP4-2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATL5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKLVNKLVDSFDHDEAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMP MATLAAVAIAHALAAGVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLAS SLACILLRYLSGGMVTPVHALGAGIRPMQGLVMEVILTFSLLFVTYAMILDPRSQVRTIG PLLTGLIVGANSLAGGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYE SLFMVNKTHEPLLNGDI Protein Names:Recommended name: Aquaporin TIP4-2 Alternative name(s): Tonoplast intrinsic protein 4-2 ZmTIP4-2 ZmTIP4;2 Gene Names:Name:TIP4-2 Expression Region:1-257 Sequence Info:fµLl length protein