ELISA Recombinant Zea mays Aquaporin NIP2-2(NIP2-2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATN2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAASTTSRTNSRVNYSNEIHDLSTVQSGSVVPTLFYPDKSIADIFPPHLGKKVISEVVA TFLLVFVTCGAASIYGEDNRRISQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFAC FRHFPWIQVPFYWAAQFTGAMCAAFVLKAVLHPIAVIGTTTPSGPHWHALLIEIVVTFNM MFVTCAVATDSRAVGELAGLAVGSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLW IYFLGPVIGTLSGAWVYTYIRFEEAPAAKDTQRLSSFKLRRMQSQLAADEFDTV Protein Names:Recommended name: Aquaporin NIP2-2 Alternative name(s): NOD26-like intrinsic protein 2-2 ZmNIP2-2 ZmNIP2;2 Gene Names:Name:NIP2-2 Synonyms:NIP2B Expression Region:1-294 Sequence Info:fµLl length protein