Skip to Content

ELISA Recombinant Staphylococcus aureus ATP synthase subunit a(atpB)

https://www.anagnostics.com/web/image/product.template/157833/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain Mu50 / ATCC 700699) Uniprot NO.:Q99SE9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIF DFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANmLGLPFSIVTKDHTLWWKSPTADATV TLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIF AGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFImLSMVYMSHKVAD EH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:SAV2109 Expression Region:1-242 Sequence Info:fµLl length protein

1,590.00 € 1590.0 EUR 1,590.00 €

1,590.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.