ELISA Recombinant Zea mays Aquaporin TIP2-1(TIP2-1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q9ATL9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKLAFGSVGDSFSATSIKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIA IAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGVFYWVAQLLGATVACLLLG FVTHGKAIPTHAVAGISELEGVVFEVVITFALVYTVYATAADPKKGSLGTIAPIAIGFIV GANILAAGPFSGGSMNPARSFGPAVAAGDFAGNWVYWVGPLVGGGLAGLVYGDVFIGGSY QQVADQDYA Protein Names:Recommended name: Aquaporin TIP2-1 Alternative name(s): Tonoplast intrinsic protein 2-1 ZmTIP2-1 ZmTIP2;1 Gene Names:Name:TIP2-1 Synonyms:TIP2A Expression Region:1-249 Sequence Info:fµLl length protein