ELISA Recombinant Rhizobium loti Phosphatidylcholine synthase(pcs)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium loti (strain MAFF303099) (Mesorhizobium loti) Uniprot NO.:Q98MN3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAARKAAKKLTDRIPRPKKKVTWPQARAFSVHLLTASGSFLAFLSLVAASEERWTAMFWW LGLALFVDGIDGPIARKLEVKEILPTWSGELLDNIIDYVTYVLIPAFALYQRGFMGEGLS FLSAAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMVVFTLFVIEPGQWVSFAVVVVAGI LTFVPINFIHPVRVVRLRPFNLTMTLLWCAFGALALAQAALAAFYDQIGVLGAQVSTFIK IGITITGLYLACIGGIMQFFPNLGAKKA Protein Names:Recommended name: Phosphatidylcholine synthase Short name= PC synthase EC= 2.7.8.24 Alternative name(s): CDP-diglyceride-choline O-phosphatidyltransferase Gene Names:Name:pcs Ordered Locus Names:mLl0506 Expression Region:1-268 Sequence Info:fµLl length protein