ELISA Recombinant Rat Potassium channel subfamily K member 9(Kcnk9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9ES08 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEVRLRGKYNISSDDYQ QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQ CEDWSFFHAYYYCFITLTTIGFGDFVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNTDEDLLEGEVAQILAGNPRRVVVRVPQSRKRHHPMYFLRKYGRTLCYLCF PGANWGDDDDDDDDAVENVVVTTPVPPAVAAAAAAATPGPSTRNVRATVHSVSCRVEEIP PDVLRNTYFRSPFGAIPPGMHTCGENHRLHIRRKSI Protein Names:Recommended name: Potassium channel subfamily K member 9 Alternative name(s): Acid-sensitive potassium channel protein TASK-3 TWIK-related acid-sensitive K(+) channel 3 Two pore potassium channel KT3.2 Short name= Two pore K(+) chan Gene Names:Name:Kcnk9 Synonyms:Task3 Expression Region:1-396 Sequence Info:fµLl length protein