ELISA Recombinant Rat coronavirus Membrane protein(M)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rat coronavirus (strain 681) (RCV-SDAV) (Sialodacryoadenitis virus SDAV-681) Uniprot NO.:Q9IKC7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSTTPAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIIL WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein Gene Names:Name:M Expression Region:1-228 Sequence Info:fµLl length protein