ELISA Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A(ORF1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Turkey astrovirus 2 (TAstV-2) Uniprot NO.:Q9ILI6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKGKTKKTVRGRKHLVTKRALGKGHFMKMRmLTDEEYQNMIEKGFSAEEIREAVNALREQ AWLNYCIDNDVDDEGEEDWYDDMVETDRVNQEIDEAIERAMEDRGEFYQKKSRLTFVEQA MMHLIQVSKERSQTAKLEVQKENEAQLVKMFERCVTDENTPEGTTSIAALSTEDDVRLVE GKVIDFTKAKNIPVDGEIRREIIPGTKCTEISTGPENKKNILKKKDTHIAEGKVETKSSQ QPVDVKDDKPVALEQRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRP IECTSCKKSFSGIEKLEDHVVSGECQKN Protein Names:Recommended name: Non-structural polyprotein 1A Cleaved into the following 4 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20' Gene Names:Name:ORF1 Expression Region:798-1125 Sequence Info:fµLl length protein