ELISA Recombinant Rat Taste receptor type 2 member 123(Tas2r123)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9JKF0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFSQKTNYSHLFTFSIIFYVEIVTGILGNGFIALVNIMDWLKRRRISTADQILTALALTR LIYVWSVLICILLLFLCPHLSMRPEMFTAIGVIWVVDNHFSIWLATCLGVFYFLKIASFS NSLFLYLKWRVKKVVLMIILISLIFLmLNISSLGMYDHFSIDVYEGNMSYNLVDSTHFPR IFLFTNSSKVFLIANSSHVFLPINSLFmLIPFTVSLVAFFVLFLSLWKHHKKMQVNAKGP RDASTMAHTKALQIGFSFLLLYAIYLLFIITGILNLDLMRCIVILLFDHISGAVFSISHS FVLILGNSKLRQATLSVLPCLRCRSKDMDTVVF Protein Names:Recommended name: Taste receptor type 2 member 123 Short name= T2R123 Alternative name(s): Taste receptor type 2 member 2 Short name= T2R2 Taste receptor type 2 member 23 Short name= T2R23 Gene Names:Name:Tas2r123 Synonyms:Tas2r14, Tas2r2, Tas2r23 Expression Region:1-333 Sequence Info:fµLl length protein