ELISA Recombinant Vibrio cholerae serotype O1 UPF0761 membrane protein VC_2742(VC_2742)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Uniprot NO.:Q9KNJ6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPmLTVLLSILSSF ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAImLISNID KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAmLGALIAAILFELSKKGFAAYITQFPSYQ LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDmLHFAPLPKNEKE Protein Names:Recommended name: UPF0761 membrane protein VC_2742 Gene Names:Ordered Locus Names:VC_2742 Expression Region:1-297 Sequence Info:fµLl length protein