ELISA Recombinant Vibrio cholerae serotype O1 Probable intracellular septation protein A(VC_1700)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Uniprot NO.:Q9KRE2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQLLDFIPLIIFFALYKFYDIYVATGALIAATTVQVIVTYAMYKKVEKMQLITFVMVAL FGGMTLALHDDNFIKWKVTIVYVVFALGLTISQIMGKPAIKGmLGKELTLPDAVWSTINW AWVMFFSGCAALNLYVAYHLPLDVWVNFKVFGLLAATLVFTLLTGGYIYKHLPHEPKQKN Q Protein Names:Recommended name: Probable intracellµLar septation protein A Gene Names:Ordered Locus Names:VC_1700 Expression Region:1-181 Sequence Info:fµLl length protein