ELISA Recombinant Rabbit Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oryctolagus cunicµLus (Rabbit)
Uniprot NO.:Q9MYS6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASMV VLCVGSKGQVFATSAIRGIRFLQILRmLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFL GLIFSSYFVYLAEKDAVNESGRVEFGSYADALWWG
Protein Names:Recommended name: Potassium voltage-gated channel subfamily KQT member 1 Alternative name(s): IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1
Gene Names:Name:KCNQ1 Synonyms:KVLQT1
Expression Region:1-155
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.