ELISA Recombinant Schizosaccharomyces pombe Palmitoyltransferase PFA5(pfa-5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9C0W9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTNLEEKQRRFSKLQKTLGVVFPAAILLSTGYTVWVFIALICVDSNIKIRNGYRNLGGG IVLIIFFFITSGLAYFSYFRVLFSSPSFCGNTLYTYYGFDNPIFLCGPNGAPRMCGTCKC WLPDRSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFYGFSAACMVLISTAIMI SRTYHYRSLPGTWIFVLVFSAFGVLFLGVmLVRHTGYLLLNINSHEAKNWKTRIYSFSVF FPEHMDSRVLVQSDPGDLPWDRGYSENWRAVMGDHWYNWILPLRRSPGDGEHFLYSPSFV SKMQSKALSMNS Protein Names:Recommended name: Palmitoyltransferase PFA5 EC= 2.3.1.- Alternative name(s): Protein fatty acyltransferase 5 Gene Names:Name:pfa-5 ORF Names:pi035, SPBC17A3.11, SPBC691.01 Expression Region:1-312 Sequence Info:fµLl length protein