ELISA Recombinant Rat EGF, latrophilin and seven transmembrane domain-containing protein 1(Eltd1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9ESC1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:THFAILMSPSTSIEVKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNL CCSLFLAQLVFLVGININTNKLVCSIIAGLLHYFFLAAFAWMCIEGIYLYLIVVGLIYNK GFLHKNFYIFGYLSPAVVVGFSASLGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNL LAFGVIIYKVFRHTAGLKPEVSCYENIRSCARGALALLFLLGTTWTFGVLHVVHASVVTA YLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLFKNVPCCFECLR Protein Names:Recommended name: EGF, latrophilin and seven transmembrane domain-containing protein 1 Alternative name(s): EGF-TM7-latrophilin-related protein Short name= ETL protein Cleaved into the following 2 chains: 1. EGF, latrophilin and seven t Gene Names:Name:Eltd1 Synonyms:Etl Expression Region:455-738 Sequence Info:fµLl length protein