Skip to Content

ELISA Recombinant Streptomyces coelicolor Protease HtpX homolog 2(htpX2)

https://www.anagnostics.com/web/image/product.template/159154/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9F2V2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHRRHNGLRTAVLLGGLSALIIVIGSFFGRAGLVVAVLVALGTNAYAYWNSDKLALRAMR ARPVSEFEAPALYRMVRELSTQARQPMPRLYISPTDAPNAFATGRNPRNAAVCCTEGIMR LLDERELRGVIGHELSHVYNRDILISSVAGALASVIMFLVNFAWLIPVGRSNDDDGPGLL GmLLImLLGPLAATVIQLAISRSREYEADASGAQLTGDPLALAGALRKLELGTKQLPLPP EPRLETASHMMIANPFRPGQGISKMFSTHPPMAERIARLEKMAGRQQ Protein Names:Recommended name: Protease HtpX homolog 2 EC= 3.4.24.- Gene Names:Name:htpX2 Ordered Locus Names:SCO4609 ORF Names:SCD39.09 Expression Region:1-287 Sequence Info:fµLl length protein

1,638.00 € 1638.0 EUR 1,638.00 €

1,638.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.