ELISA Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase(Ebp)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:Q9JJ46
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTNmLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFSFSGVLIVITWLLSSRVSVVPLGTG RRLALCWFAVCTFIHLVIEGWFSFYHEILLEDQAFLSQLWKEYSKGDSRYILSDGFIVCM ESVTACLWGPLSLWVVIAFLRHQPFRFVLQLVVSVGQIYGDVLYFLTELRDGFQHGELGH PLYFWFYFVIMNAIWLVIPGILVFDAIKHLTNAQSmLDNKVMKIKSKHN
Protein Names:Recommended name: 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase EC= 5.3.3.5 Alternative name(s): Cholestenol Delta-isomerase Delta(8)-Delta(7) sterol isomerase Short name= D8-D7 sterol isomerase Emopamil-binding protein
Gene Names:Name:Ebp Synonyms:Rsi
Expression Region:2-230
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.