ELISA Recombinant Xenopus laevis Lysophosphatidic acid receptor 1-B(lpar1-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q9PU16 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSLSEFVSEPIGMMSQTSAASESQCYYNETIAFFYNRSGKYLDTEWNAVSKLVMGLGIT VCIFImLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTV STWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTVAIVM GAIPSVGWNCICDLEHCSNMAPLYSDSYLIFWTIFNLVTFVVMVVLYAHIFVYVRQRTMR MSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCNILAYEKFFLL LAEFNSAMNPIIYSYRDKEMSATFKQILCCQRTENVNGPTEGSDRSASSLNHTILAGVHS NDHSVV Protein Names:Recommended name: Lysophosphatidic acid receptor 1-B Short name= LPA receptor 1-B Short name= LPA-1-B Alternative name(s): Lysophosphatidic acid receptor LPA1 homolog 2 Short name= xLPA1-2 Gene Names:Name:lpar1-b Synonyms:lpa1r, lpa1r2 Expression Region:1-366 Sequence Info:fµLl length protein