Skip to Content

ELISA Recombinant Rat Sphingomyelin phosphodiesterase 2(Smpd2)

https://www.anagnostics.com/web/image/product.template/152993/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9ET64 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKHNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLESFDLALLEEVWSEQDFQYLK QKLSLTYPDAHYFRSGIIGSGLCVFSRHPIQEIVQHVYTLNGYPYKFYHGDWFCGKAVGL LVLHLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKKANVVLLCGDLN MHPKDLGCCLLKEWTGLRDAFVETEDFKGSEDGCTMVPKNCYVSQQDLGPFPFGVRIDYV LYKAVSGFHICCKTLKTTTGCDPHNGTPFSDHEALMATLCVKHSPPQEDPCSAHGSAERS ALISALREARTELGRGIAQARWWAALFGYVMILGLSLLVLLCVLAAGEEAREVAImLWTP SVGLVLGAGAVYLFHKQEAKSLCRAQAEIQHVLTRTTETQDLGSEPHPTHCRQQEADRAE EK Protein Names:Recommended name: Sphingomyelin phosphodiesterase 2 EC= 3.1.4.12 Alternative name(s): Lyso-platelet-activating factor-phospholipase C Short name= Lyso-PAF-PLC Neutral sphingomyelinase Short name= N-SMase Short name= Gene Names:Name:Smpd2 Expression Region:1-422 Sequence Info:fµLl length protein

1,780.00 € 1780.0 EUR 1,780.00 €

1,780.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.