ELISA Recombinant Pseudomonas aeruginosa Protein-export membrane protein SecG(secG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9HV52 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGIL AAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAG DVPAAPEQK Protein Names:Recommended name: Protein-export membrane protein SecG Gene Names:Name:secG Ordered Locus Names:PA4747 Expression Region:1-129 Sequence Info:fµLl length protein