ELISA Recombinant Pseudomonas aeruginosa Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9HZK8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANQESTTRTLLVALVVCLVSSVFVAGAAVALKPTQAENRLLDKQRSILAIAGLGEPGMS GKEVKALFDSRITAKVVDLQSGTFSDAQDPLGYDPLKAAKDPALSDALPAAEDIASIKRR ERYTTVYLVETDGKLDTLILPVRGYGLWSTLYGFLALKGDLNTVAGFGFYQHGETPGLGG EVDNPKWKALWVGKTLYDAQGDLAVQIIKGSVDPQSAKATHQVDGLAGATLTSKGVDNLL HFWLGKDGFDAFLANLRKGEA Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C Gene Names:Name:nqrC Ordered Locus Names:PA2997 Expression Region:1-261 Sequence Info:fµLl length protein