ELISA Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit J(nuoJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9I0J3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEFAFYFAAGVAVLATLRVITNSNPVHALLYLIISLLAISMTFFSLGAPFAGALEIIVYA GAIMVLFVFVVMmLNLGPAVVEQERKWLTPGIWVGPSALALVLLVELLVVLARTPSGAGI GHTTVDAKAVGISLYGPYLLVVELASmLLLAALVAAYHLGRQDAKQ Protein Names:Recommended name: NADH-quinone oxidoreductase subunit J EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit J NDH-1 subunit J Gene Names:Name:nuoJ Ordered Locus Names:PA2645 Expression Region:1-166 Sequence Info:fµLl length protein