ELISA Recombinant Pseudomonas aeruginosa Ubiquinol oxidase subunit 2(cyoA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9I427 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CDMTLFNPKGQVGMDERTLIITATLLmLIVVIPVIVMTLAFAWKYRASNTQAEYKPDWHH SNRIEAVVWLVPCVIIAILGWITWESTHKLDPYRPLDSEVKPVTIQAVSLDWKWLFIYPE QGIATVNEIAFPKDTPVNFQITSDSVMNSFFIPQLGSQIYSMAGMMTKLHLIANEEGVFD GISANYSGGGFSGMRFKAIATSEQGFQDWVAKVKAAPASLSIGTYPELVKPSENVPPTYF SSVSPELFGHILTKYEHHGDAKGAAHGEHAGAEHEAAMTGHDMQDMDMQAMQGMKDMKDM HMQPSTQE Protein Names:Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome o subunit 2 Cytochrome o ubiquinol oxidase subunit 2 Oxidase BO(3) subunit 2 Ubiquinol oxidase polypeptide II Gene Names:Name:cyoA Ordered Locus Names:PA1317 Expression Region:24-331 Sequence Info:fµLl length protein