ELISA Recombinant Saguinus oedipus CD81 protein(CD81)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saguinus oedipus (Cotton-top tamarin) Uniprot NO.:Q9N0J9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLNCCGSSTLSALTTSmLKNNLCPSGSS IISNLFKEDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY Protein Names:Recommended name: CD81 protein Alternative name(s): CD_antigen= CD81 Gene Names:Name:CD81 Expression Region:1-236 Sequence Info:fµLl length protein