ELISA Recombinant Arabidopsis thaliana Putative cytochrome c oxidase subunit 5C-4(At5g40382)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9FNE0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANVQKIGKAVYKGPSVVKEIIYGITLGFAVGGLWKMHHWNNQRRTKEFYDLLEKGEISV VVEDE Protein Names:Recommended name: Putative cytochrome c oxidase subunit 5C-4 Alternative name(s): Cytochrome c oxidase polypeptide Vc-4 Gene Names:Ordered Locus Names:At5g40382 ORF Names:MPO12.11 Expression Region:1-65 Sequence Info:fµLl length protein