ELISA Recombinant Pseudomonas aeruginosa Lipoprotein signal peptidase(lspA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9HVM5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPDVDRFGRLPWLWITVLVFVLDQVSKAFFQAELSMYQQIVVIPDLFSWTLAYNTGAAFS FLADSSGWQRWLFALIAIVVSASLVVWLKRLKKGETWLAIALALVLGGALGNLYDRMVLG HVVDFILVHWQNRWYFPAFNLADSAITVGAVmLALDMFRSKKSGEAAHG Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II Gene Names:Name:lspA Synonyms:ls Ordered Locus Names:PA4559 Expression Region:1-169 Sequence Info:fµLl length protein