ELISA Recombinant Xenopus laevis Probable N-acetyltransferase camello(cml)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q9I8W5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANVSIRKYKNSDYETVNFLFVEGTKEHLPAACWNTLKKPRFYFIIIVACASIFMCTSSY VLSLTSLVALLAVGWYGLYLEFHGYASRCQREDmLDIENSYMMSDNTCFWVAEIDRKVVG IVGAKPLKEADDELFLLHLSVARDCRQQRIGTKLCQTVIDFARQRGFKAVCLETANIQDA AIKLYEAVGFKKSLVAIPPFLLNQYTSFTVIYYRYDIKS Protein Names:Recommended name: Probable N-acetyltransferase camello EC= 2.3.1.- Alternative name(s): XcmL Gene Names:Name:cmL Expression Region:1-219 Sequence Info:fµLl length protein