ELISA Recombinant Schizosaccharomyces pombe UPF0382 membrane protein C1782.12c(SPAC1782.12c)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9P7G8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AYGSHGLQKRVQDPHLLKSWSTACTYLMFHSLATMAVSLHPVYGKSRWTGPLLITGSCLF SGTIYGLCLLPKGHSLRRILGPLTPIGGLVmLTGWATmLV Protein Names:Recommended name: UPF0382 membrane protein C1782.12c Gene Names:ORF Names:SPAC1782.12c Expression Region:19-118 Sequence Info:fµLl length protein