ELISA Recombinant Rat Transmembrane protein 150A(Tmem150a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9QZE9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVMNRHVCPVENWSYNDSCSPDPAEQGGPKTCCTLDDVPLISKCGTYPPESCLFSLIGN MGAFMVALICLLRYGQLLEQNRHSWINTTALITGCTNAAGLVVVGNFQVDHAKSLHYIGA GVAFPAGLLFVCLHCVLFYHGATTPLDMAMAYLRSVLAVIAFVTLVLSGVFFLHESSELQ HGAALCEWVFVLDILIFYGTFSYEFGAVSSDTLVAALQPAPGRACKSSGSSSTSTHLNCA PESIAMI Protein Names:Recommended name: Transmembrane protein 150A Alternative name(s): Fasting-inducible integral membrane protein TM6P1 Transmembrane protein 150 Gene Names:Name:Tmem150a Synonyms:Tm6p1, Tmem150 Expression Region:25-271 Sequence Info:fµLl length protein