ELISA Recombinant Pseudomonas stutzeri Electron transport complex protein RnfE(rnfE)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (Pseudomonas perfectomarina) Uniprot NO.:Q9EVN2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSQCGSADVTAPKPKGLFNYFSSALWDYNVALVQmLALCPALAVTTTATNGLGMGLATT LVLMITNAIISALRHSISPAVRNPLMIGIIAGVVTLIDMAINAWMHELYKVLGLFIALIV TNCAVLGRAESFCSRNPVLPSILDGRRAWASGFTWVLVVIGGIREILGQRARCSPRPRLL LGEHFRWLEITVLPGFQGILLAILPPGAFIVLGFVLAFKRVVDRRRAERRIRTHGELVVL Q Protein Names:Recommended name: Electron transport complex protein RnfE Alternative name(s): Nitrogen fixation protein RnfE Gene Names:Name:rnfE Expression Region:1-241 Sequence Info:fµLl length protein