ELISA Recombinant Streptomyces coelicolor NADH-quinone oxidoreductase subunit K 1(nuoK1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:Q9F2V6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHLAYPAVLSALLFCTGLYGVLARRNAILVLMSVELmLNAVNLNLVAFDVWLSRAAEETL HSGQALTLFTIAIAAAEIGIGLAIVLAVHRNRGTSDIDKLRDTAEGHEPDGPDTDTPATG TAAEKAEATA Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 1 NDH-1 subunit K 1 Gene Names:Name:nuoK1 Ordered Locus Names:SCO4605 ORF Names:SCD39.05 Expression Region:1-130 Sequence Info:fµLl length protein