ELISA Recombinant Thermoplasma acidophilum UPF0290 protein Ta0107(Ta0107)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) Uniprot NO.:Q9HLW7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQSIILFIPALIANSGAVITGGHFIIDRGKKFIDGRRILGNGKTLSGYAGGIAIGTVTGF IIYLISTLFNYALGTYGTLAEAIIIPFIMATGSLTGDIAGSFVKRRIGIDRGGKGGLLDQ WPFALMAFLFLYIFERPFFMYHYFYVTMIVILVIVPPIHRAVNIIGYKMHKKDVPW Protein Names:Recommended name: UPF0290 protein Ta0107 Gene Names:Ordered Locus Names:Ta0107 Expression Region:1-176 Sequence Info:fµLl length protein