ELISA Recombinant Pseudomonas aeruginosa Heme exporter protein B(ccmB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Uniprot NO.:Q9I3N6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNVFSLLLAREARLLFRRPAELANPLVFFAIVIALFPLAVGPESQLLQTLSPGLVWVAA LLAVLLSLEGLFRSDFEDGSMEQWVLSPHPLALLVLAKVLAHWLFSGLALVLMSPLFALM LGLPARCIPVLLLSLLLGTPVLSLLGAVGAALTVGLKRGGLLLALLILPLYIPVLILGSG ALQASLQGLPSSGHLLWLASLTALALTLTPFAIAAGLKISVGE Protein Names:Recommended name: Heme exporter protein B Alternative name(s): Cytochrome c-type biogenesis protein CcmB Gene Names:Name:ccmB Ordered Locus Names:PA1476 Expression Region:1-223 Sequence Info:fµLl length protein