ELISA Recombinant Rat Taste receptor type 2 member 7(Tas2r7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9JKE9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTYETDTTLMFVAVCEALVGILGNAFIALVNFMGWMKNRKITAIDLILSSLAMSRICLQC IILLDCIILVQYPDTYNRGKEMRIIDFFWTLTNHLSVWFATCLSIFYFFKIANFFHPLFL WIKWRIDKLILRTLLACLILSLCFSLPVTENLTDDFRRCVKTKERINSTLRCKLNKAGYA SVKVNLNLVmLFPFSVSLVSFLLLILSLWRHTRQMQLNVTGYNDPSTTAHVKATKAVISF LVLFIVYCLAFLIATSSYFMPESELAVIWGELIALIYPSSHSFILILGNSKLKQASVRVL CRVKTmLKGRKY Protein Names:Recommended name: Taste receptor type 2 member 7 Short name= T2R7 Alternative name(s): Taste receptor type 2 member 6 Short name= T2R6 Gene Names:Name:Tas2r7 Synonyms:Tas2r6 Expression Region:1-312 Sequence Info:fµLl length protein