ELISA Recombinant Rat Probable N-acetyltransferase CML5(Cml5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9QXS7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALYQIRQYQERDHKHVVDLFSSGIKEHIPAAFRYTLLLPKTLLFLFAAPLTIVLASGSW LLAVVCIFFLLLLLRFLAGQPFKEYVAMCLQTDMADITKSYLNSHGSFWVAESGGQVVGI VAALPVKESPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQFARDQGYTDVVLETSIIQ QGAMTLYEAMGFQRTGKNLENSIIKWLIGFFFISFHVCFPFCSGT Protein Names:Recommended name: Probable N-acetyltransferase CmL5 EC= 2.3.1.- Alternative name(s): Camello-like protein 5 Gene Names:Name:CmL5 Expression Region:1-225 Sequence Info:fµLl length protein