ELISA Recombinant Rhizobium meliloti NADH-quinone oxidoreductase subunit K 2(nuoK2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q9EV71 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPLWWSILLGVALFVIGAGGVLLRRNILIVLMSLELLLNSVNINFIAFGQYYDDFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTIMKG Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2 Gene Names:Name:nuoK2 Ordered Locus Names:RA0840 ORF Names:SMa1544 Expression Region:1-100 Sequence Info:fµLl length protein