Skip to Content

ELISA Recombinant Rhodobacter sphaeroides Glucans biosynthesis glucosyltransferase H(opgH)

https://www.anagnostics.com/web/image/product.template/153683/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q9FA52 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPAERRRRAVTLASRLVAAAISLTAAAGAFFLFLQFGSTDGLDSMDITRSVLILVSTSWL GWGAAHAVLGLFSRPQRPANVSPDAPISTRTVILVPVYNEDPVATFSRIAAMDASLAATP WRDLFHFAILSDTRDEAIAARERFWFLRLLRERDAEGRIFYRRRAVNRGRKAGNIEDFIQ KSGSAYPFAVILDADSLMEGETLVDMVRRMEAEPRLGLLQTLPVVTKARARFGRSMQFSA ALHAPVFARGLAMMQGRTGPFWGHNAIVRVQAFAESCGLPELSGPPPFGGHVMSHDYVEA ALLARAGWIVRFDDDIRGSYEEGPENLVDHAKRDRRWCQGNLQHGRILFAPGLCGWNRFV FLQGIMAYIAPLFWLGFIMASIAAPFFAPPLDYFPVPYWPFPVFPSDETWKAIGLAVGIF GLLLLPKLMIAIEAIVTGRAAGFGGAGRVLVSTLAELVFSSIIAPILMAFQTRSVLQVLL GRDGGWPTNNRGDGSLSVAQAWSASHWIVTWGLIGIGATYYFAPGLVPWLLPVALPMIFS PLVIAVTSKRSRSALFTMPLEVAPTPVLLAHDAILADWERSPAPEAVPALAVSHA Protein Names:Recommended name: Glucans biosynthesis glucosyltransferase H EC= 2.4.1.- Gene Names:Name:opgH Ordered Locus Names:RHOS4_17340 ORF Names:RSP_0127 Expression Region:1-595 Sequence Info:fµLl length protein

1,963.00 € 1963.0 EUR 1,963.00 €

1,963.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.