ELISA Recombinant Schizosaccharomyces pombe UPF0645 membrane protein C20H4.02(SPAC20H4.02)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9HE10 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSSALKKWEIVIRFASSIPDLSLEISDAQTTTIHSLFKIVRNRIPECRDKQLKMVFQGR LLSPGFTVERAVRGNWQRDENDDPNIVQKAFIHCIVGPTLTEEELASQDQAQSGLNSNSE SPDDLQNAQTGETLRGFDRLREAGFTETEVNNLRSQFHRLRGTNLDSLTEDAIREAEDDW IDNGGQNSSADELDMSYETLLAGVLIGFFGGAIACYFLWERTMFSLRMQLSILVGIICNF AYGLLHSYRW Protein Names:Recommended name: UPF0645 membrane protein C20H4.02 Gene Names:ORF Names:SPAC20H4.02 Expression Region:1-250 Sequence Info:fµLl length protein