ELISA Recombinant Rat Taste receptor type 2 member 16(Tas2r16)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9JKU0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPTQVTIFSIIMYVLESLVIIVQSCTTVAVLFREWMHFQRLSPVEIILISLGISHFCLQ WTSmLYNFGTYSRPVLLFWKVSVVWEFMNVLTFWLTSLLAVLYCVKVSSFSHPVFLWLRL KILKLVLWLLLGALIASCLSIIPSVVKYHIQMELLTLDHLPKNSSLILRLQMFEWYFSNP FKMIGFGVPFLVFLISIILLTVSLVQHWGQMKHYSSSSSSLRAQCTVLKSLATFFIFFTS YFLTIVVSFIGTVFDKKSWFWVCEAVIYGLVCIHFTSLMMSNPTLKKALRLQFWSPESS Protein Names:Recommended name: Taste receptor type 2 member 16 Short name= T2R16 Alternative name(s): T2R18 T2R3 Gene Names:Name:Tas2r16 Synonyms:Tas2r18, Tas2r3 Expression Region:1-299 Sequence Info:fµLl length protein