ELISA Recombinant Vibrio cholerae serotype O1 UPF0114 protein VC_0208(VC_0208)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Uniprot NO.:Q9KVD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERLIEKLLYSSRWIMAPIYLGLSLLLLALGIKFFQEIFHLLPNIFTIKEVDLILVALSL IDVSLVGGLIVMVMFSGYENFVSKLDVDESEDKLGWLGKLDTSSLKNKVSASIVAISSIH LLKVFMNTENIESDKIKWYLLLHITFVVSAFAMGYLDKITKK Protein Names:Recommended name: UPF0114 protein VC_0208 Gene Names:Ordered Locus Names:VC_0208 Expression Region:1-162 Sequence Info:fµLl length protein