ELISA Recombinant Rabbit fibroma virus E3 ubiquitin-protein ligase LAP(s153R)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rabbit fibroma virus (strain Kasza) (RFV) (Shope fibroma virus (strain Kasza))
Uniprot NO.:Q9Q8T2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTIVDMVDVSLVDKCCWICKESCDVVRNYCKCRGDNKIVHKECLEEWINTDTVKNKSCA ICETPYNVKQQYKKLTKWRCYRRDCHDSLLVNLPLCLIVGGISTYTLVSVEIIKLMESEE TSELTKVFLVTSFLGPFIVTVLSALRTCIDCRTYFLTTRKRNTIHTLQELEDDDDDDDDD DDDDDEEYADAVEEIIIGPSN
Protein Names:Recommended name: E3 ubiquitin-protein ligase LAP EC= 6.3.2.- Alternative name(s): Leukemia associated protein Short name= LAP
Gene Names:Ordered Locus Names:s153R
Expression Region:1-201
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.