ELISA Recombinant Thermoplasma acidophilum Protease HtpX homolog(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) Uniprot NO.:Q9HJV2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLMSIRLKLSSLLMGIAIFAIGFGIIYAILYYIGLNIGAIALLMVLLPIFIIMDIVQWL FGPYMIGAVYRTHKLQPTEPEYNmLTSIVSEVARNNNIRMPEVYIAEVDMPNAFAYGSPI AGRRIAVTRGLLRILEPDEIKAVIGHEMGHLRHRDVEmLLAIGLIPTLIFYFGYTLLFSG ERGRNAGGIVLLAIIAMAASFLFRFLILAFNRMRESYADVNSALTVDGGAEKLQTALAKI VAATGRTGRYTRRRRNTPSSSVTEmLFFSNPNQSANEDYRKLLEEWKTAKVSLFADFFSD HPHPAKRIQRLEKLKMS Protein Names:Recommended name: Protease HtpX homolog EC= 3.4.24.- Gene Names:Name:htpX Ordered Locus Names:Ta0861 Expression Region:1-317 Sequence Info:fµLl length protein