ELISA Recombinant Rhizobium meliloti Phosphatidylcholine synthase(pcs)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q9KJY8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKFFNYRRVPYAEIRAFSVHILTASGSFLAFLGVVAAAEHRFVDMFWWLGLALLVDGIDG PIARKVQVKEVLPNWSGDTLDNVIDYVTYVLLPAFALYQSGMIGEPWSFVAAGAIVVSSA IYYADMGMKTDEYFFSGFPVVWNMVVFTLFVIQASEVTASIVVFLSVILTFLPINFLHPV RVKRLRPLNLGIFLVWSVLGMYALLLHFETPPWVVVGVVATGLYLYVIGFILQIFPKLGR A Protein Names:Recommended name: Phosphatidylcholine synthase Short name= PC synthase EC= 2.7.8.24 Alternative name(s): CDP-diglyceride-choline O-phosphatidyltransferase Gene Names:Name:pcs Ordered Locus Names:R01672 ORF Names:SMc00247 Expression Region:1-241 Sequence Info:fµLl length protein