Skip to Content

ELISA Recombinant Prochlorococcus marinus Divinyl chlorophyll a-b light-harvesting protein pcbE(pcbE)

https://www.anagnostics.com/web/image/product.template/150523/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) Uniprot NO.:Q9L8M2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQTYGNPDPTYGWWVGNSVVTNKSSRFIGSHVAHTGLIAFTAGANTLWELARFNPDIPMG HQGMVSIPHLASLGIGFDQAGAWTGQDVAFVGIFHLICSFVYALAGLLHSVIFSEDTQNS SGLFADGRPEHRQAARFKLEWDNPDNQTFILGHHLVFFGVANIWFVEWARVHGIYDPAIE AIRQVNYNLDLTQIWNHQFDFIQIDSLEDVMGGHAFLAFFQIGGGAFHIATKQIGTYTNF KGAGLLSAEAVLSWSLAGIGWMAIIAAFWCATNTTVYPEAWYGETLQLKFGISPYWIDTG NMDGVVTGHTSRAWLSNVHYYLGFFFIQGHLWHAIRAMGFDFRKVTSAVANLDNSRITLS D Protein Names:Recommended name: Divinyl chlorophyll a/b light-harvesting protein pcbE Gene Names:Name:pcbE Ordered Locus Names:Pro_1450 Expression Region:1-361 Sequence Info:fµLl length protein

1,716.00 € 1716.0 EUR 1,716.00 €

1,716.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.