ELISA Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp38(tvp38)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:Q9P781 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPAPIALAAIGILIVVFAILLAVFHNDLLAIAMPIAERIAKLPMSFLIALVLIAASSIPP LLGQDPLALLIGAVWGLNVGFWTVVCGIFIGETIAFMAYRYFLEQKAQEFREHHEEHYGT FVKIVEEGSYPLIWLIRLSFLPTHFTTVFFATLPELSYIGWAIAFWLSCFKYLVPVYAGY CIVHNKSSAANIVGIVLSIVVTLGTLAFLIVRYKAIKNSTLEDSTNSTSDVLNHLESQPT DSIDLRHLEQTSEQNETDNSERKHLLSHQH Protein Names:Recommended name: Golgi apparatus membrane protein tvp38 Gene Names:Name:tvp38 ORF Names:SPBC1711.09c Expression Region:1-270 Sequence Info:fµLl length protein