Skip to Content

ELISA Recombinant Rat Intermediate conductance calcium-activated potassium channel protein 4(Kcnn4)

https://www.anagnostics.com/web/image/product.template/152445/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9QYW1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEmLWFLGCKWVLYLLL VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV PLRSPHCTLAGEATDSQAWPGFLGEGEALLSLAmLLRLYLVPRAVLLRSGVLLNASYRSI GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW LIPITFLTIGYGDVVPGTLWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKmLAAIHTFRQVRLKHRKLR EQVNSMVDISKMHMILCDLQLGLSASHLALEKRIDGLAGKLDALTELLSTALQQQQPPEP IQEAT Protein Names:Recommended name: Intermediate conductance calcium-activated potassium channel protein 4 Short name= SK4 Short name= SKCa 4 Short name= SKCa4 Alternative name(s): IK1 KCa3.1 KCa4 Gene Names:Name:Kcnn4 Synonyms:Ik1, Sk4, Smik Expression Region:1-425 Sequence Info:fµLl length protein

1,784.00 € 1784.0 EUR 1,784.00 €

1,784.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.