ELISA Recombinant Rat Leukotriene B4 receptor 1(Ltb4r)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q9R0Q2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAANTTSTAATSSPGGMSLSLLPIVLLSVALVVGLPGNSFVVWSILKRMQKRSVTALLVL NLALADLAVLLTAPFFLHFLARGTWSFEVTGCRLCHYVCGVSMYASVLLITIMSLDRSLA VARPFVSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVTPKNKTLICDSRYPSDGHKV FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL VNLVEAGRTLAGWDKNSPAGQRLKLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VVKLLEGTGSEVSSTRRGGTLVQTPKATPTCPEPGPTDSFMTSSTPPESSK Protein Names:Recommended name: Leukotriene B4 receptor 1 Short name= LTB4-R 1 Short name= LTB4-R1 Gene Names:Name:Ltb4r Synonyms:Blt Expression Region:1-351 Sequence Info:fµLl length protein